PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco005024.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family FAR1
Protein Properties Length: 891aa    MW: 97712.5 Da    PI: 8.9419
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco005024.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1293.5e-091421745991
         FAR1  59 rtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                     Cka+++v ++++g+w v+kl+ eHnH+l p
  Aco005024.1 142 SDRCKAMMEVVLKEHGRWAVSKLVAEHNHPLLP 174
                  567***************************975 PP

2FAR157.73.8e-18545619178
         FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwev 78 
                  +fY +YA++vGF++rk    k+ rn  + +r +vCs+eg+r ++ ++  +++++r+etrtgC+a++ ++ +++gk+ +
  Aco005024.1 545 EFYVRYATTVGFNIRKGWWDKTARNV-TRSRVYVCSREGFRPKNITT--DTKKPRPETRTGCQARMAIRITSSGKYSI 619
                  6********************96666.99**************9987..999***********************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031019.5E-7142174IPR004330FAR1 DNA binding domain
PfamPF031012.1E-15545619IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 891 aa     Download sequence    Send to blast
MVLIAEILDD AANDEEGRSS KERGGGGTSE EAKENCDNPK PSSDKPEVVV PTSENETETK  60
EPTAIDDSPN LCHAPSAAET SSSSAPATGP PPEQPLYNEY ALRVAYIMRS YLSMRQPNFT  120
DAAAASGGVG PSSAADAATG SSDRCKAMME VVLKEHGRWA VSKLVAEHNH PLLPPPEGCV  180
SAPAVPVMGM EFESAEAAKA FYYGYGESSG FKARTGSNRR SSGSGALIMQ RFLCWRGSYL  240
MYRNNQGTFT GKRKRGPYKK RALKAAQETA ASERDGDVTN GAASNGLIEE LQSSPTLNDS  300
LAAGEGAGAK AAAASAVGLE TASAEVKDDW KGKDDAKAIP AANTSQSRLL RELGVRVSRY  360
TNEERRNIIL KYMMKRNNRP GVERPSKVPS RQALARRRQR GSGGRFLSTG EPKVFQRGNL  420
YLKGASEALE DILVGQKRRS QRIKHWMKGT SKVATGAFLV EENHRQTSFT EKPRIILAIP  480
LDHALAEGRQ QGRVGKILGE GESQTSSKVG EVTESEADAA AEISTDTGGE PKVGMVFLNE  540
DKAYEFYVRY ATTVGFNIRK GWWDKTARNV TRSRVYVCSR EGFRPKNITT DTKKPRPETR  600
TGCQARMAIR ITSSGKYSIL LKEYLKPEID IPSFVKQLDK LVEEKRYAEL LADYHANQGI  660
SRIPPLRLLW QAATAYTPSI FEQFRMEFEL FLGCMSDQLL EQVENILQTR LNAVSKGQQQ  720
TLVQNEGNIN EFSRKASRKK NKNGEDRCRH QNPLESNKRQ KGRQGVYDEA NGVRGDEPSA  780
ALPDIPAHPR NPPNQFLSSS QFMQTPYVPS HQFGLGPVQG IHEMTQFSQE SSSAALPPQP  840
FHSSSQLTQN AVQGCPAPDV HSLQFVASNP QLGEQSTDQR HCTIPLWDFL *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1737760RKKNKNGEDRCRHQNPLESNKRQK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010942431.11e-101PREDICTED: protein FAR1-RELATED SEQUENCE 4-like
RefseqXP_010942439.11e-101PREDICTED: protein FAR1-RELATED SEQUENCE 4-like
RefseqXP_010942448.11e-101PREDICTED: protein FAR1-RELATED SEQUENCE 4-like
RefseqXP_010942458.11e-101PREDICTED: protein FAR1-RELATED SEQUENCE 4-like
STRINGSb01g006380.14e-50(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP148331318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.22e-14FAR1 family protein